PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 534aa    MW: 58796.4 Da    PI: 5.0709
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029793.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS433.91.2e-1321635331374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+e+L +cA+a++++d++ +++l + l++++s +g+p+qRl ay++e+L arla+s+s+++++l+++e +   s+e l+++++++ev+P++kf+++ a
  Pbr029793.1 163 LKEVLCACAKALANNDMSTTEQLFSSLRQMVSVSGEPIQRLGAYILEGLIARLASSGSSICASLRCKEPA---SAELLSYMHILYEVCPYFKFGYMSA 257
                  5789*****************************************************************9...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea++ e+rvHiiDf++ qG QW++L+qaLa+Rp+gpp++RiTg+++++s   +   l  +g+rL+++Ae+++vpfef++ +    ++++le+L
  Pbr029793.1 258 NGAIAEAMKDESRVHIIDFQVAQGSQWITLIQALATRPGGPPQIRITGIDDSTSAyvRGGGLGVVGQRLSRLAESCKVPFEFHA-AGIFGSEVQLEDL 354
                  ***************************************************998899999************************.78899******** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                   ++pgEa+aVn++l+lh+++desv+++++rd++L+l kslsPkvv++veqe+++n+ +Fl rf+e+l+y+sa+fds+++ lpre++eri+vE+++l+r
  Pbr029793.1 355 VIRPGEAIAVNFALMLHHIPDESVNSHNHRDRLLRLAKSLSPKVVTLVEQESNTNAVPFLPRFTETLSYFSAVFDSIDVALPREHRERINVEQHCLAR 452
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  eivn++acegaer+er e l+kWr+r+ +aGF+p pls  +++++k+ll+ ++++ y++ee  g+l+lgW+++pLv+ +aWr
  Pbr029793.1 453 EIVNIIACEGAERVERYEPLSKWRSRFIMAGFSPCPLSPLVNATIKTLLQSYSEK-YTLEEMGGALYLGWMNQPLVVSCAWR 533
                  *****************************************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.17137514IPR005202Transcription factor GRAS
PfamPF035144.2E-130163533IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MRESHKHIIP NVPRQIGEQP VEEPESSFQN VEQQASSDEV VQGTQLSVQR FEQHCTLESS  60
SGTSGYPGRS SSSSLNFSAN GSPASHPDVH SYHSCGSPVN QSCISNETDD LGHKIRELEN  120
ALLGNDSDAF DAYNIIDEVG ANQIYSEAEN WEQMMMMIRG SDLKEVLCAC AKALANNDMS  180
TTEQLFSSLR QMVSVSGEPI QRLGAYILEG LIARLASSGS SICASLRCKE PASAELLSYM  240
HILYEVCPYF KFGYMSANGA IAEAMKDESR VHIIDFQVAQ GSQWITLIQA LATRPGGPPQ  300
IRITGIDDST SAYVRGGGLG VVGQRLSRLA ESCKVPFEFH AAGIFGSEVQ LEDLVIRPGE  360
AIAVNFALML HHIPDESVNS HNHRDRLLRL AKSLSPKVVT LVEQESNTNA VPFLPRFTET  420
LSYFSAVFDS IDVALPREHR ERINVEQHCL AREIVNIIAC EGAERVERYE PLSKWRSRFI  480
MAGFSPCPLS PLVNATIKTL LQSYSEKYTL EEMGGALYLG WMNQPLVVSC AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-661675338375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338895.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_009338900.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLM5X1200.0M5X120_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s37270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein